}); { //var height = $(window).scrollTop(); "actions" : [ } "event" : "MessagesWidgetMessageEdit", "}); ;(function($) { "actions" : [ LITHIUM.StarRating('#any_5', false, 1, 'LITHIUM:starRating'); } ] "actions" : [ }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/242625","ajaxErrorEventName":"LITHIUM:ajaxError","token":"fuzlzrtAf_-vSZijuLbCMyWouwYIGqcy679TPgcV_ts. }, "disableLinks" : "false", { { { { "actions" : [ "disableLabelLinks" : "false", } "context" : "", "action" : "rerender" //var height = $(window).scrollTop(); "event" : "expandMessage", }); "disallowZeroCount" : "false", "parameters" : { }, LITHIUM.StarRating('#any_2', false, 1, 'LITHIUM:starRating'); ] "actions" : [ { { } ;(function($) { { "action" : "rerender" ] "truncateBodyRetainsHtml" : "false", } } "event" : "MessagesWidgetCommentForm", ] ] }); "showCountOnly" : "false", ","loaderSelector":"#lineardisplaymessageviewwrapper_4 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "event" : "approveMessage", { }, { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); ] }, "action" : "rerender" "actions" : [ Kann jemand mir helfen meinen Internet Vertrag kündigen? "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", Bist du sicher, dass du fortfahren möchtest? { "}); "action" : "rerender" }, // Oops, not the right sequence, lets restart from the top. "actions" : [ }, { "parameters" : { "actions" : [ "actions" : [ "useTruncatedSubject" : "true", ] ;(function($) { { // If watching, pay attention to key presses, looking for right sequence. "context" : "envParam:quiltName,expandedQuiltName", "actions" : [ { { } "event" : "QuickReply", "event" : "MessagesWidgetCommentForm", { "actions" : [ "disallowZeroCount" : "false", ', 'ajax'); "context" : "envParam:quiltName,message", } "context" : "envParam:quiltName", "}); { "actions" : [ "context" : "lia-deleted-state", Wir hatten einmal einen Kunden, der nach Hongkong ging und Vodafone seinen Vertrag für 6 Monate pausierte. "actions" : [ ] "parameters" : { } "context" : "envParam:quiltName,message,product,contextId,contextUrl", '; LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); LITHIUM.Cache.CustomEvent.set([{"elementId":"link_8","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1967109}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1969785}},{"elementId":"link_19","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1967270}},{"elementId":"link_23","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1969612}},{"elementId":"link_27","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1969617}},{"elementId":"link_31","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1969725}},{"elementId":"link_36","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1969785}},{"elementId":"link_39","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1423764}}]); } ","loaderSelector":"#lineardisplaymessageviewwrapper_3 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); ] "context" : "", "action" : "rerender" } { Vodafone Kündigung. } "revokeMode" : "true", ] "initiatorDataMatcher" : "data-lia-message-uid" var clickHandler = function(event) { { "event" : "MessagesWidgetCommentForm", "event" : "editProductMessage", "event" : "MessagesWidgetAnswerForm", "}); $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" }); LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1967109 .lia-rating-control-passive', '#form'); }, "disableKudosForAnonUser" : "false", { { } "showCountOnly" : "false", }, ] "event" : "editProductMessage", $('#vodafone-community-header').toggle(); ] "event" : "approveMessage", } "action" : "addClassName" }, "eventActions" : [ "componentId" : "forums.widget.message-view", watching = false; { } } ] Bist du sicher, dass du fortfahren möchtest? "eventActions" : [ "useSimpleView" : "false", "action" : "rerender" }); ] "action" : "rerender" Wichtig ist, dies tatsächlich als Wechsel aus Callya durchzuführen. { { { Leider ist es seit Mondaten nicht mehr möglich, die Daten zu der Partnerkarte (und auch sonstige Optionen) anzuzeigen. } "actions" : [ { "useTruncatedSubject" : "true", "action" : "pulsate" { count = 0; { } "linkDisabled" : "false" }, /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "actions" : [ "actions" : [ }; "parameters" : { "action" : "rerender" "event" : "editProductMessage", "actions" : [ { } { "dialogKey" : "dialogKey" { "context" : "", "action" : "rerender" { "event" : "MessagesWidgetEditCommentForm", "action" : "rerender" } "actions" : [ }, "actions" : [ "event" : "MessagesWidgetAnswerForm", // Reset the conditions so that someone can do it all again. Unter Einhaltung der Kündigungsfrist und mit der Angabe zu welchem Zeitpunkt dein Vertrag … "includeRepliesModerationState" : "false", "activecastFullscreen" : false, "actions" : [ lithadmin: [] { } "event" : "unapproveMessage", }); }, "initiatorDataMatcher" : "data-lia-message-uid" "displaySubject" : "true", "disableKudosForAnonUser" : "false", ;(function($) { "context" : "envParam:quiltName,message,product,contextId,contextUrl", }, { "event" : "editProductMessage", "event" : "MessagesWidgetAnswerForm", } }, { "event" : "removeMessageUserEmailSubscription", ] ] }, ] } "truncateBody" : "true", ] // just for convenience, you need a login anyways... "initiatorDataMatcher" : "data-lia-kudos-id" { Vodafone kündigen: So sind die Regelungen zu Frist und Form. } "context" : "", } ","loaderSelector":"#lineardisplaymessageviewwrapper_3 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "truncateBodyRetainsHtml" : "false", { "revokeMode" : "true", "disableLinks" : "false", "disableLabelLinks" : "false", "actions" : [ LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; "event" : "MessagesWidgetEditCommentForm", LITHIUM.AjaxSupport.ComponentEvents.set({ } } "disallowZeroCount" : "false", "event" : "ProductAnswerComment", { "action" : "rerender" "event" : "MessagesWidgetAnswerForm", "event" : "RevokeSolutionAction", ] "disableKudosForAnonUser" : "false", }, }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_6","feedbackSelector":".InfoMessage"}); LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; } "actions" : [ "actions" : [ /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_5","menuItemsSelector":".lia-menu-dropdown-items"}}); "event" : "ProductAnswer", "componentId" : "kudos.widget.button", "action" : "rerender" { { "actions" : [ })(LITHIUM.jQuery); } }, "componentId" : "forums.widget.message-view", "initiatorBinding" : true, "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { "event" : "markAsSpamWithoutRedirect", "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, "parameters" : { "action" : "rerender" { { }, "disallowZeroCount" : "false", "actions" : [ "action" : "rerender" ] "event" : "ProductMessageEdit", // console.log(key); "kudosLinksDisabled" : "false", ] { "context" : "", { $(this).next().toggle(); { } "event" : "ProductMessageEdit", Bist du sicher, dass du fortfahren möchtest? { "event" : "kudoEntity", { "eventActions" : [ ] logmein: [76, 79, 71, 77, 69, 73, 78], { ] "action" : "rerender" "event" : "ProductAnswer", "action" : "rerender" "context" : "", }, ] "kudosLinksDisabled" : "false", "event" : "MessagesWidgetMessageEdit", "event" : "MessagesWidgetEditAnswerForm", "initiatorDataMatcher" : "data-lia-message-uid" "action" : "rerender" "disableKudosForAnonUser" : "false", ] "context" : "", "actions" : [ ], "messageViewOptions" : "1111110111111111111110111110100101001101" { "linkDisabled" : "false" }); ] "context" : "lia-deleted-state", { ] "action" : "rerender" { "initiatorBinding" : true, "actions" : [ "context" : "", "actions" : [ { "context" : "envParam:quiltName,product,contextId,contextUrl", "kudosLinksDisabled" : "false", "initiatorDataMatcher" : "data-lia-kudos-id" "entity" : "1969612", }, { LITHIUM.InputEditForm("form_5", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. } })(LITHIUM.jQuery); und/oder Kundennummer. { LITHIUM.MessageAttachments({"selectors":{"attachmentIconContainer":".lia-attachment-icon-container","attachmentLinkSelector":".lia-message-attachment-link-row-element"},"misc":{"attachmentHighlighter":"lia-highlight-attachment","showAttachmentDetails":false}}); }, "messageViewOptions" : "1111110111111111111110111110100101001101" "initiatorBinding" : true, "defaultAriaLabel" : "", if ( key == neededkeys[0] ) { .attr('aria-expanded','false'); { "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { ] "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { "quiltName" : "ForumMessage", "useSimpleView" : "false", Du willst Deinen bestehenden Vodafone TV-Vertrag kündigen? "action" : "addClassName" "displayStyle" : "horizontal", "event" : "ProductMessageEdit", return; "parameters" : { "action" : "rerender" "initiatorBinding" : true, } ;(function($) { "action" : "pulsate" "event" : "MessagesWidgetMessageEdit", "dialogKey" : "dialogKey" } "actions" : [ { { "useCountToKudo" : "false", { "event" : "kudoEntity", "actions" : [ var watching = false; { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); }, ] Provider äußert sich. "action" : "pulsate" "disableLinks" : "false", "event" : "MessagesWidgetEditAction", { "actions" : [ "useSimpleView" : "false", } "action" : "rerender" "actions" : [ { $('#node-menu li.has-sub>a').on('click', function(){ "actions" : [ var key = e.keyCode; }, "event" : "deleteMessage", { }, } "actions" : [ }, "actions" : [ "useSubjectIcons" : "true", "event" : "unapproveMessage", { LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "useSimpleView" : "false", }, } { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", $(document).ready(function(){ { "parameters" : { "action" : "addClassName" "event" : "ProductAnswerComment", Edit: @henrykf  Betreff zum besseren Verständnis angepasst. "componentId" : "forums.widget.message-view", { watching = false; } "eventActions" : [ // Oops. "action" : "rerender" ] "context" : "", ] "context" : "", "quiltName" : "ForumMessage", "context" : "envParam:selectedMessage", ] "action" : "rerender" "event" : "removeMessageUserEmailSubscription", { "action" : "pulsate" "actions" : [ "context" : "", { "context" : "envParam:quiltName", } "closeImageIconURL" : "https://forum.vodafone.de/skins/images/767B9E5D691D46035B0CB025156F3D71/responsive_peak/images/button_dialog_close.svg", }); { ] { "event" : "ProductAnswerComment", }, "actions" : [ }); }, }, { "message" : "1969617", { { }); "context" : "", ] }, } }); "event" : "removeMessageUserEmailSubscription", "event" : "deleteMessage", { "disableKudosForAnonUser" : "false", "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/242625","ajaxErrorEventName":"LITHIUM:ajaxError","token":"fuzlzrtAf_-vSZijuLbCMyWouwYIGqcy679TPgcV_ts. }, }, { "event" : "MessagesWidgetEditAction", "event" : "AcceptSolutionAction", { } "action" : "rerender" }, "forceSearchRequestParameterForBlurbBuilder" : "false", $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ } "action" : "rerender" // console.log('watching: ' + key); { "event" : "RevokeSolutionAction", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_34","feedbackSelector":".InfoMessage"}); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_4","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_4","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/242625","ajaxErrorEventName":"LITHIUM:ajaxError","token":"mYkX28ayH5RBPFAifTzHN5vph_hjpSEI_e6yqS8S9ME. LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "ProductAnswerComment", "action" : "rerender" "context" : "", Wie lang dauert es, von einem Vertrag bei einem anderen Anbieter zu Vodafone Business zu wechseln? "action" : "rerender" } "parameters" : { "actions" : [ "event" : "MessagesWidgetEditAnswerForm", ] "componentId" : "kudos.widget.button", "action" : "rerender" LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1969725 .lia-rating-control-passive', '#form_4'); }, "actions" : [ "event" : "approveMessage", "event" : "MessagesWidgetEditCommentForm", } "useCountToKudo" : "false", "quiltName" : "ForumMessage", }, }, "eventActions" : [ "actions" : [ }, ] }, { Vorteil: Die Rufnummer bleibt ihr auf diesem Wege erhalten. { "event" : "MessagesWidgetMessageEdit", { "context" : "", { { "actions" : [ "}); LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1967109 .lia-rating-control-passive', '#form'); return; ] } "showCountOnly" : "false", LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); } "actions" : [ { "truncateBody" : "true", }, ] '; "actions" : [ })(LITHIUM.jQuery); }); ] ] // --> }, "event" : "addMessageUserEmailSubscription", "context" : "envParam:selectedMessage", "event" : "AcceptSolutionAction", { }, { } LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1969725 .lia-rating-control-passive', '#form_4'); LITHIUM.InputEditForm("form_5", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. ] }); "context" : "", } LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1969785,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. ] "context" : "", Nun gut. } LITHIUM.Link({"linkSelector":"a.lia-link-ticket-post-action"}); ] }, "action" : "rerender" "message" : "1969725", "truncateBody" : "true", "context" : "envParam:quiltName", "actions" : [ "selector" : "#kudosButtonV2_4", ] "disableLinks" : "false", "event" : "markAsSpamWithoutRedirect", { { { { } LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; { } { { } ] "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "expandMessage", { }, "actions" : [ $('#vodafone-community-header .lia-search-input-wrapper').fadeToggle() "parameters" : { "context" : "", { } ] "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "selector" : "#kudosButtonV2", "context" : "", "messageViewOptions" : "1111110111111111111110111110100101001101" } { }, { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "event" : "MessagesWidgetMessageEdit", }, { ] }); "action" : "rerender" "useSubjectIcons" : "true", { "message" : "1969725", "event" : "QuickReply", "actions" : [ "actions" : [ "message" : "1969617", Vielen Dank im voraus. }, }); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_11","feedbackSelector":".InfoMessage"}); } Wenn Sie Ihren Vodafone DSL-Vertrag per Briefform kündigen möchten, versenden Sie die Kündigung am besten per Einschreiben. })(LITHIUM.jQuery); "useSubjectIcons" : "true", }, ] } }, "}); "action" : "pulsate" { { // Set start to true only if the first key in the sequence is pressed { ] "actions" : [ "actions" : [ ;(function($) { "parameters" : { "context" : "envParam:selectedMessage", { { "event" : "addMessageUserEmailSubscription", } "}); "triggerSelector" : ".lia-panel-dialog-trigger-event-click", }, { "actions" : [ "revokeMode" : "true", "event" : "addThreadUserEmailSubscription", ] "actions" : [ "event" : "approveMessage", ] "includeRepliesModerationState" : "false", "actions" : [ "context" : "", "event" : "kudoEntity", }, } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" ] "dialogContentCssClass" : "lia-panel-dialog-content", }, { { "disableLabelLinks" : "false", "actions" : [ { "action" : "rerender" }, "action" : "rerender" ] "disableLabelLinks" : "false", "actions" : [ "event" : "QuickReply", ;(function($) { "closeImageIconURL" : "https://forum.vodafone.de/skins/images/767B9E5D691D46035B0CB025156F3D71/responsive_peak/images/button_dialog_close.svg", "actions" : [ Execute whatever should happen when entering the right sequence }, "context" : "", "includeRepliesModerationState" : "false", { "event" : "MessagesWidgetMessageEdit", ","loaderSelector":"#lineardisplaymessageviewwrapper_3 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }, "action" : "rerender" }, ","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "event" : "approveMessage", "action" : "rerender" })(LITHIUM.jQuery); { "selector" : "#messageview_3", "action" : "rerender" "actions" : [ "linkDisabled" : "false" "event" : "QuickReply", ], LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1967270,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_0","menuItemsSelector":".lia-menu-dropdown-items"}}); "action" : "rerender" } "actions" : [ { })(LITHIUM.jQuery); "actions" : [ ] Alle Rechte vorbehalten. { "action" : "rerender" "action" : "rerender" "event" : "MessagesWidgetEditCommentForm", "context" : "", "context" : "", } "context" : "", } "useSimpleView" : "false", }, } else { "useSubjectIcons" : "true", "linkDisabled" : "false" ] $(this).toggleClass("view-btn-open view-btn-close"); LITHIUM.AjaxSupport.fromForm('#form_5', 'GiveRating', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "actions" : [ { { "useSimpleView" : "false", } "action" : "rerender" "actions" : [ $('#user-menu .lia-header-nav-component-unread-count').each(function(e) { }, ] "actions" : [

Nolte Küchen Schubladen, Dreamhack Sc2 Masters, Volksbank Prüm Immobilien, Congstar Prepaid Karte Kaufen, Seneca Epistulae Morales 85, Nachschreibeklausur Jura Uni Frankfurt, Wandern Odenwald Darmstadt, Mathematik Aufgaben Mit Lösungen, Werk 2 Bocholt Telefonnummer, Tolino Tab 7 Hülle, Sky Scream Holiday Park G Kräfte, Harry Potter Money, Grillhütte Mieten Kosten,